PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr019258.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NAC
Protein Properties Length: 379aa    MW: 42572.8 Da    PI: 7.3013
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr019258.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.16.1e-52151412128
          NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kge 98 
                   pGfrFhPtdeelv +yLk+k++++ l++ e ik+vdiyk++PwdLpk ++++ekewyf+++rd+ky+++ r+nr+t +g+Wkatg+d++++s+ +++
  Pbr019258.1  15 LPGFRFHPTDEELVGFYLKRKIQQRLLPI-ELIKQVDIYKYDPWDLPKLASTGEKEWYFYCPRDRKYRNSARPNRVTGAGFWKATGTDRPIYSSeGTK 111
                  69***************************.89***************9888999***************************************95666 PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                   +glkk+Lvfy+gra kg ktdW+mhe+rl
  Pbr019258.1 112 CIGLKKSLVFYRGRAAKGIKTDWMMHEFRL 141
                  7***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.84E-5713172IPR003441NAC domain
PROSITE profilePS5100556.75814172IPR003441NAC domain
PfamPF023651.2E-2516141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0045770Biological Processpositive regulation of asymmetric cell division
GO:0048103Biological Processsomatic stem cell division
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MEEKNEMERV DDVILPGFRF HPTDEELVGF YLKRKIQQRL LPIELIKQVD IYKYDPWDLP  60
KLASTGEKEW YFYCPRDRKY RNSARPNRVT GAGFWKATGT DRPIYSSEGT KCIGLKKSLV  120
FYRGRAAKGI KTDWMMHEFR LPSLSDSAPP KKFLDKSLPA NDSWAICRIF KKTNSMAQRA  180
LSHSWASQFP EPTASNLFTQ QFSSENMSCT TDMGSTMQFW NNNDLQQPSN TNFSAFDTLP  240
YKPINPTVSK PSMFDGELPN GFMFSPVEMS GPMNSALIGD LSNPAGSIDF DGSQQQFTGF  300
SISLQQQDQL QGNIGTSENE GGFRKNVSSS STSQWGTSSV RSIGFPFSLA SEDEAWKPTL  360
PSDSPPCPSS YSTNKCYT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-531617517171Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00537DAPTransfer from AT5G39820Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009376262.10.0PREDICTED: protein FEZ-like
TrEMBLD9ZJ980.0D9ZJ98_MALDO; NAC domain class transcription factor
STRINGPOPTR_0017s11830.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20133490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39820.11e-106NAC domain containing protein 94